PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_EFEC50B26.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 311aa    MW: 34205.8 Da    PI: 8.0374
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_EFEC50B26.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.66.9e-3088144259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK v+g e+prsYY+Ct+a+Cpvkkkve+sa  +++++i+Y+g+Hnh+
  Traes_4BL_EFEC50B26.2  88 DDGYNWRKYGQKAVQGGEYPRSYYKCTHASCPVKKKVEHSA-YGQITQIIYRGQHNHQ 144
                            8****************************************.9**************8 PP

2WRKY37.64.3e-12254276123
                            ---SS-EEEEEEE--TT-SS-EE CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
                            ldDgy+WrKYGqK+vkg+++pr 
  Traes_4BL_EFEC50B26.2 254 LDDGYRWRKYGQKVVKGNPHPRM 276
                            59********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-2782146IPR003657WRKY domain
SuperFamilySSF1182902.35E-2485146IPR003657WRKY domain
SMARTSM007742.9E-3087145IPR003657WRKY domain
PfamPF031065.7E-2388144IPR003657WRKY domain
PROSITE profilePS5081122.2488146IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-13241278IPR003657WRKY domain
SuperFamilySSF1182901.57E-10246278IPR003657WRKY domain
PROSITE profilePS5081115.939249284IPR003657WRKY domain
SMARTSM007743.8E-7254298IPR003657WRKY domain
PfamPF031061.7E-8255278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSHQQALAQV TAQAVHSQYT VGSQADYSLP FSSATSALTS QFIKSSANVT SMKETATLPL  60
HTVNDNLKSN EVSQGFQTLA LTVDKPADDG YNWRKYGQKA VQGGEYPRSY YKCTHASCPV  120
KKKVEHSAYG QITQIIYRGQ HNHQRPPKRR SKDGGNLLNE DDFPENRDAL TRSEPGSQDH  180
SGKVEVSNDG ITGLSMSKRR DGGDQSSGSS DREEDNDEAG DDNGDAGIVN ANKRHVPVPA  240
QRIIVQTTSE IDLLDDGYRW RKYGQKVVKG NPHPRMVFEK VDSSFHPGIL DLSHLHTPCC  300
ILVVKGRGVG R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-17871471475WRKY transcription factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144149RPPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273950.0KR827395.1 Triticum aestivum WRKY44 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559732.11e-148PREDICTED: probable WRKY transcription factor 4
RefseqXP_010233399.11e-148PREDICTED: probable WRKY transcription factor 4
TrEMBLW5E8880.0W5E888_WHEAT; Uncharacterized protein
STRINGMLOC_31894.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-50WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]